Urocortin III (UCN3) decreases food intake and delays gastric emptying activity. UCN3 is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. UCN3 is a 38aa long peptide that corresponds to aa123-160 of the mouse precursor.Mouse: H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 or H-FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2