Urocortin II (UCN2) is a 38aa long endogenous peptide (mouse, rat) in the corticotrophin-releasing factor (CRF) family. UCN2 decreases food intake and delays gastric emptying activity. Urocortin II is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. Mouse UCN2 differs from rat UCN2 by 1 aa but can be used equally with rat animal models.Mouse: H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2 or H-VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2