The pancreatic prohormone (Pancreatic Polypeptide or PPY) is synthesized in the pancreatic islets of Langherans. PPY regulates pancreatic and gastrointestinal functions. PPY is cleaved into 2 chains, a 36-aa pancreatic hormone (PH, Cat. No. 350327, human sequence) and a 20-aa pancreatic icosapeptide (PI). Obinepitide, a PPY derivative with Gln63, is tested in clinical trials for the treatment of obesity.Human: H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 or H-APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2